• Aquatic Therapy Strength Training Benefits for the Leg Strength of Children with Cerebral Palsy

      Quick, Elizabeth; Department of Biological Sciences (Augusta University, 2015-05)
      The purpose of this thesis is to track the aspects and results of applying aquatic therapy strength training exercises to children with cerebral palsy and determine whether or not the therapy is beneficial for leg strengthening in comparison to a usual physical therapy clinical setting. The experiment was carried out twice a week, for 12 weeks. Two groups of six children with cerebral palsy participated in the experiment, in which they were administered leg strengthening exercises.
    • Are NFL teams getting the most out of their wins? The Efficiency of Year End Revenues of Ten NFL Teams

      Gonzales, Savanna; Thompson, Mark; Hull College of Business; Thompson, Mark; Hull College of Business; Hoffman, Todd; Department of English and Foreign Languages; Hunt, David; Pamplin College; Augusta University (2018-02-12)
      Major sports have taken over many prominent industries in today's world. With the economic impact of athletics comes its evolution from a spectator event into a business. Each team in the major leagues is now not only pressured to produce winsbut as a business, they must also bring in revenue. This means that efficiencyof funds is a vital goal of team managers and financial specialists. Thisresearch projectexaminesthe effects of various factors on year-end revenues for the top ten most valuable teams in the National Football League. Through the use of a DEA model that analyzes such inputs as income, team record and stand out players we areable to determine how efficiently each team is performing based on their revenues, or the output. Of the 10 teams studied, 5 were deemed efficient while 5 were deemed inefficient.Teams that didnot see successful revenue reports were analyzed based on their weaknesses and offered recommendations on which to improve where efficient teams were used a comparison. Ultimately, the goal of this research is to identify factors to improve revenue efficiency across the league as a whole by looking at the top performing teams (or best practices).
    • Are NFL teams getting the most out of their wins? The Efficiency of Year End Revenues of Ten NFL Teams

      Gonzales, Savanna; Department of Management and Marketing (Augusta University, 2018-05)
      Major sports have taken over many prominent industries in today's world. With the economic impact of athletics comes its evolution from a spectator event into a business. Each team in the major leagues is now not only pressured to produce winsbut as a business, they must also bring in revenue. This means that efficiencyof funds is a vital goal of team managers and financial specialists. Thisresearch projectexaminesthe effects of various factors on year-end revenues for the top ten most valuable teams in the National Football League. Through the use of a DEA model that analyzes such inputs as income, team record and stand out players we areable to determine how efficiently each team is performing based on their revenues, or the output. Of the 10 teams studied, 5 were deemed efficient while 5 were deemed inefficient.Teams that didnot see successful revenue reports were analyzed based on their weaknesses and offered recommendations on which to improve where efficient teams were used a comparison. Ultimately, the goal of this research is to identify factors to improve revenue efficiency across the league as a whole by looking at the top performing teams (or best practices).
    • The Art of Conservation: The Federal Duck Stamp

      Harris, Kirstyn; Department of History, Anthropology, & Philosophy (Augusta University, 2019-12)
      President Franklin Roosevelt signed the Duck Stamp Act into law in 1934. The Duck Stamp Act states that any waterfowl hunter over the age of 16 years old must buy a Federal Duck Stamp and that the sales from the stamp go to the Migratory Bird Conservation Fund. In the beginning, the government selected an artist to paint the stamp. After a few years of debates, there was a proposal to form the Federal Duck Stamp contest in which anyone could participate. This is the longest-running government controlled contest in the United States.
    • Artificial Chromosome Transgenesis Reveals Long-Distance Negative Regulation of ragl in Zebrafish

      Jessen, Jason R.; Department of Biochemistry and Molecular Biology (1999-11)
      Despite the essential roles played by the recombination activating genes (ragl and rag2) during V(D)J recombination, the mechanisms that restrict their expression to lymphoid cells are undefined. Using a novel approach to achieve artificial chromosome transgenesis in zebrafish, we demonstrate that distal regulatory elements are critical to suppress ragl expression in inappropriate tissues. In contrast to smaller reporter gene constructs, 125 and 75 kb artificial chromosomes containing the zebrafish rag genomic locus directed GFP expression in a pattern reflective of endogenous rag 1. Mapping experiments identified a positive element 5' of ragl that enhances GFP expression in both lymphoid and non-lymphoid tissues and a negative element 5' of ra g l that specifically suppresses GFP expression in the skeletal muscle. Our transgenic zebrafish also express GFP in olfactory neurons which we show represent an authentic ra g l expression site in zebrafish.
    • Asian Pride & Prejudice: The Relationship Between Ethnic Identity & Mental Illness Stigma

      Fang, Shawn; Department of Psychological Sciences (2017-03)
      As Asian health professionals increasingly diversify the medical workplace, their early upbringing – characterized by acculturation, social identity, and “face” concern – may potentially exert influence on their own perceptions of mental illness. Such perceptions, often stigmatizing against others, could impact provision of medical care to the community at large. This study examines the hypothesized correlation between 1) strength of ethnic identity – as measured by an adapted version of the East Asian Ethnic Identity Scale – and 2) degree of mental illness stigma – as measured by an adapted pre-medical student version of the Mental Illness: Clinician’s Attitudes Scale. Conclusions will stem from statistical analysis of self-report online survey responses from Asian full-time college students enrolled in healthcare-oriented undergraduate studies (i.e. medicine, nursing, physical therapy, etc.). The broad aim of this study is to discern how the influence of ethnic identity could potentially interact with and predict mental illness stigma in the future patient care provided by aspiring Asian healthcare professionals. My presentation will discuss the literature-based premise for studying the intersection of culture and stigma, and I will summarize proposed protocol for the research process.
    • Assessing Blackworms as a Model for Studying AVM

      Frazier, Eric; Wiley, Faith; Department of Biological Sciences (2017-03)
      Avian Vacuolar Myelinopathy (AVM) is a neurological disease that affects certain species of birds within the Southeastern region of the United States. Research suggests that this disease is linked to the consumption of a cyanobacterial species inhabiting hydrilla, an invasive aquatic weed. The objective of this experiment is to assess whether blackworms are a good model for studying AVM. Blackworms are invertebrate organisms usually found in marshes, swamps and ponds. These organisms are commonly used in toxicity testing due to many factors such as having a low level of maintenance and being cost efficient. Blackworms were initially exposed to concentrated extracts of hydrilla/cyanobacteria for a period of five days. There was no difference in mortality between control and treatment worms. Two additional experiments are currently being conducted to examine potential sublethal effects. Regrowth of blackworm body segments and rate of asexual reproduction are being examined in worms exposed to the hydrilla extracts, as well as to water and sediment collected from Lake Thurmond, GA during an AVM event.
    • Assessing Local Parks For Their Infrastructure Availability And Use Along With Physical Activity Levels Of The Local Children

      Shabu, Elizabath; Department of Kinesiology (Augusta University, 2020-05)
      This research project assessed public park physical activity infrastructure use in Richmond and Columbia Counties. Prior research has shown that children not only enjoy outdoor time, but also consider parks as a place for socializing. Furthermore, research has shown that playground time positively impacts children’s imagination. The playground also aids in the physical fitness of children by offering interactive experiences that can add to the recommended 60 minutes of physical activity a day. Park assessments were conducted utilizing the Physical Activity Resource Assessment (PARA) Tool and found that overall, parks in both counties were well taken care of. Additionally, there was a wide variety of amenities available to utilize. There were some areas of concern in the parks, however, including cigarette buds, alcohol containers, trash, and cracked sidewalks. In both counties, parks were observed to see how much children utilized the playground equipment. Observations concluded that the majority of children utilized the different variety of equipment, with the swings and slides being the most common. In conclusion, this presentation will describe the diversity of amenities, challenges in maintenance, and the overall use of public parks in both Richmond and Columbia Counties.
    • Assessing Local Parks for their Infrastructure, Issues, and Use

      Shabu, Elizabath; Kinesiology (Augusta University Libraries, 2020-05-04)
      This item presents the abstract for a poster presentation at the 21st Annual Phi Kappa Phi Student Research and Fine Arts Conference.
    • Assessing Medical Students Knowledge in Diagnosis and Initial Treatment of Depression

      Youssef, Nagy A.; Thomas, Andria; Ange, Brittany; Yassa, Mark; Boswell, Elizabeth; Wallach, Paul M.; Department of Psychiatry and Health Behavior; Department of Psychological Sciences; Department of Chemistry and Physics; Augusta University (2017-03)
      Depression is one of the leading causes of premature death, and one of the highest burdens of overall disability. Depression rates are around 13% in primary care settings. Depressive episodes are still underdiagnosed and undertreated. Factors that contribute to this include lack of detailed knowledge, lack of confidence in treatments among others. Thus, addressing these gaps would improve patients care. Moreover, bipolar depression can be difficult to distinguish from unipolar; and requires a different treatment. Improving education of students in these areas would improve care for patients. Aims are as follows: 1) assess students’ level of confidence and knowledge in diagnosing and treating depression, and any barriers to gaps in knowledge, 2) assess students’ knowledge in differential diagnosis of depression and any barriers to gaps in knowledge. We are assessing these by an online survey on website used by Medical College of Georgia for student questionnaires, sent to all third-year medical students after internal medicine rotation. The survey is sent through academic affairs office. This will provide valuable knowledge in improving our education and curriculum for the new generation of physicians.
    • Assessing the Validity of Vitamin D Supplementation in Patients with Symptomatic Knee Osteoarthritis

      Campbell, Caroline; Harris, Matthew; Littlejohn, Rodney; Paletta, Nina; Stone, David; Williams, Ashley; Medical College of Georgia (2016-05)
      In an older adult population, does supplementation of 25-hydroxyvitamin D for patients with symptomatic knee osteoarthritis with low serum vitamin D alleviate symptoms of the disease?
    • Assessment of p65 in the Novel Microglial NF-κB Animal Model

      Frerichs, Ryan; Department of Biological Sciences (Augusta University, 2021-05)
    • Assessment of Renal Ischemia Reperfusion Induced Injury in Male and Female Rats

      Crislip, Gene Ryan; Department of Physiology (2017)
      Acute kidney injury (AKI) is a clinical problem often induced by ischemia reperfusion (IR). Males are reported to have worse outcomes following IR compared to females based on measurements of blood urea nitrogen and creatinine. However, these markers are produced at different levels depending on body mass. The goal of Aims 1 and 2 was to do a complete assessment of the impact of sex on IR to establish a model that displays a sex difference. We measured multiple markers, including inulin clearance which is the gold standard of determining renal function. We determined there is no sex difference in response to IR after 24 hours. However, males had impaired renal function, higher vascular congestion and tubular injury than females 7 days following IR. A consequence of vascular congestion and tubular injury is fluid leakage into interstitial space, which increases renal volume. The goal of Aim 3 was to determine if ultrasound could be used as a tool to detect progressive changes in regional kidney volume following IR. To do this, we compared renal volume measurements with stereological assessment and examined the use of renal volume as an injury marker following IR. We verified the use of ultrasound to monitor renal volume after IR and the changes in volume correlated with the extent of medullary injury. Limiting vascular congestion improves recovery following IR. Pericytes are contractile cells that line the vessels in the renal medulla that are prone to congestion following IR. The goal of Aim 4 was to determine the role of renal pericytes following IR. To do this, we decreased pericytes in rats before IR to determine if this effected injury. We found that lower pericyte density was associated with greater vascular congestion following IR, additionally, males lose more pericytes than females. From these studies, we concluded that there was no sex difference in IR induced injury after 24 hours, however, following 7 days males had poorer recovery than females. We hypothesize that this poorer recovery is attributed to less pericytes in males following IR resulting in the inability to reduce vascular congestion compared to females.
    • Assessments Evaluating the Relationship Between Psychosocial Factors and Upper Extremity Trauma: A Scoping Review

      Coleman, Isabelle; Glaze, Morgan; Griffin, Caroline; Holbrooks, Sarah Beth; Moore, Kristen; Department of Occupational Therapy (Augusta University, 2021-09)
      Objectives of Presentation: At the conclusion of this presentation, attendees will: ● Identify 3 current assessments available that evaluate the psychosocial components of upper extremity (UE) recovery after trauma. ● Discuss 3 of the most common types of psychosocial challenges often experienced by individuals with UE trauma. Clinical/Research Question: What assessments are available for examining the relationships between psychosocial factors and UE trauma during rehabilitation of adults with UE trauma?
    • The association between fitness, metabolic levels, and cognitive performance in an older population

      Dojack, Amanda; Department of Kinesiology (Augusta University, 2018-05)
    • Association between Genetic Variants in DNA and Histone Methylation and Telomere Length

      Kim, Sangmi; Parks, Christine G.; Xu, Zongli; Carswell, Gleta; DeRoo, Lisa A.; Sandler, Dale P.; Taylor, Jack A.; Department of Medicine (2012-07-11)
      Telomere length, a biomarker of aging and age-related diseases, exhibits wide variation between individuals. Common genetic variation may explain some of the individual differences in telomere length. To date, however, only a few genetic variants have been identified in the previous genome-wide association studies. As emerging data suggest epigenetic regulation of telomere length, we investigated 72 single nucleotide polymorphisms (SNPs) in 46 genes that involve DNA and histone methylation as well as telomerase and telomere-binding proteins and DNA damage response. Genotyping and quantification of telomere length were performed in blood samples from 989 non-Hispanic white participants of the Sister Study, a prospective cohort of women aged 35–74 years. The association of each SNP with logarithmically-transformed relative telomere length was estimated using multivariate linear regression. Six SNPs were associated with relative telomere length in blood cells with p-values<0.05 (uncorrected for multiple comparisons). The minor alleles of BHMT rs3733890 G>A (p = 0.041), MTRR rs2966952 C>T (p = 0.002) and EHMT2 rs558702 G>A (p = 0.008) were associated with shorter telomeres, while minor alleles of ATM rs1801516 G>A (p = 0.031), MTR rs1805087 A>G (p = 0.038) and PRMT8 rs12299470 G>A (p = 0.019) were associated with longer telomeres. Five of these SNPs are located in genes coding for proteins involved in DNA and histone methylation. Our results are consistent with recent findings that chromatin structure is epigenetically regulated and may influence the genomic integrity of telomeric region and telomere length maintenance. Larger studies with greater coverage of the genes implicated in DNA methylation and histone modifications are warranted to replicate these findings.
    • Asymptomatic Severe Hypocalcemia Secondary to Vitamin D Deficiency in an Elderly Patient

      Aldasouqi, Saleh; Glassy, Crystal M.; Glassy, Matthew S.; Treska, Anxhela; Caldwell-McMillan, Molly; Gossain, Ved; Department of Medicine (2011-11-2)
    • Attenuating the Interaction Between Delta Protein Kinase C and the "d" Subunit of FIFo ATp Synthase Protects Against Cardiac Ischemia/Repferusion injury

      Walker, Matthew; Deparment of Pharmacology and Toxicology (6/3/2016)
      Cardiac ischemia / reperfusion (IR) injury most often results from the thrombotic blockade of the coronary arteries and is the most frequent cause of death in humans. Despite the significant role energy deprivation plays in cardiac IR injury, few studies have targeted the IR-induced impairment of the mitochondrial F1Fo ATP synthase. We have previously demonstrated delta protein kinase C (δPKC) involvement in cardiac myocyte energy deprivation via its interaction with the “d” subunit of F1Fo ATP synthase (dF1Fo) and have developed a peptide inhibitor [NH2YGRKKRQRRMLATRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK- COOH] of this interaction. It targets to the mitochondrial matrix / inner membrane. The inhibitor peptide contains a FLAG epitope which allowed confirmation of its uptake into cardiac mitochondria. Our early studies in neonatal cardiac myocytes (NCMs) led us to the hypothesis that PKC inhibits ATP production in vivo via an interaction with dF1Fo to exacerbate cardiac IR injury. To directly test our hypothesis, we first utilized the Langendorff isolated heart model to show that PKC co-immunoprecipitates (co-IPs) with antisera to dF1Fo in myocardium exposed to simulated IR injury. Administration of the inhibitor peptide to the isolated rat hearts prior to cardiac IR attenuated the co-IP of 􀁇PKC with dF1Fo, improved recovery of contractility, diminished levels of tissue t-carbonyls and 4-hydroxy-2-nonenal (HNE), and reduced myocardial infarct size (as assessed by 2, 3, 5 triphenyltetrazolium chloride (TTC) staining) following simulated IR exposures. Additionally, this peptide enhanced ATP levels 2.1 fold, improved ADP-stimulated mitochondrial respiration, and attenuated Ca++-induced mitochondrial swelling in ischemic myocardium. We next evaluated the inhibitor peptide in an in situ rat coronary ligation model for its ability to protect live rats from cardiac IR injury. A 10 min coronary ligation increased the PKC-dF1Fo co-IP in the region at risk (RAR) by 5-fold which was attenuated by 71% with intravenous infusion of the inhibitor peptide. This response correlated with an enhancement of ATP levels, a 2-fold reduction in oxidative stress markers, improvement in systolic cardiac function, and a reduction in TTC monitored myocardial infarct size in the RAR. These results support further development of this peptide as a first-in-class-translational therapeutic for the treatment of cardiac IR injury.
    • Attitudes About Differential Treatment of Crack and Cocaine in Terms of Legality

      Pollard, Elinita M.; Department of Psychological Sciences (Augusta University, 2020-12)
      Attitudes concerning addiction influence how an individual feels about a plethora of issues related to substance abuse. Broadus and Evans (2015) developed an instrument to measure an individual’s attitude toward addiction called the Public Attitudes About Addictions Survey (PAAAS). Their research suggested that an individual’s perception of drug addiction aligns with one of the following models of addiction: the psychological model, sociological model, disease model, nature model, or moral model. Broadus and Evans argue one’s attitude may influence how an individual feels about receiving addiction counseling, drug-related judicial decisions, and formation of drug policy (2015). This study is concerned with whether one’s attitude toward addiction and one’s knowledge about cocaine are related to opinions about sentencing for drug crimes and particularly different sentencing for crack and cocaine offenses.
    • Atypical Magnesium Requirements in a Phyllite Population of Rare Plant Species, Pediomelum Piedmontatum

      Zimmerman, Matthew; Biological Sciences (Augusta University Libraries, 2020-05-04)
      This item presents the abstract for an oral presentation at the 21st Annual Phi Kappa Phi Student Research and Fine Arts Conference.